PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02169.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 300aa    MW: 31923.9 Da    PI: 9.0361
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02169.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171964147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  +g+W+ eEd llv++v+q+G ++W+ I++ ++ gR++k+c++rw + 
  Zmw_sc02169.1.g00060.1.am.mk 19 KGPWSIEEDALLVRLVEQHGANHWSVISAAIP-GRSGKSCRLRWCNQ 64
                                  79******************************.***********985 PP

2Myb_DNA-binding57.53.1e-1873115347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   ++T+eEd l++ a++ +G++ W++Iar+++ gRt++ +k++w++ 
  Zmw_sc02169.1.g00060.1.am.mk  73 PFTQEEDALILAAHAHYGNR-WAAIARHLP-GRTDNAIKNHWNSN 115
                                   89******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.6691465IPR017930Myb domain
SuperFamilySSF466894.31E-3216112IPR009057Homeodomain-like
SMARTSM007179.6E-161867IPR001005SANT/Myb domain
PfamPF002492.5E-161964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-242072IPR009057Homeodomain-like
CDDcd001671.27E-142163No hitNo description
PROSITE profilePS5129426.74966120IPR017930Myb domain
SMARTSM007174.0E-1770118IPR001005SANT/Myb domain
PfamPF002494.7E-1673115IPR001005SANT/Myb domain
CDDcd001671.31E-1473116No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2373119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDPMRANPAS MSASSGVKKG PWSIEEDALL VRLVEQHGAN HWSVISAAIP GRSGKSCRLR  60
WCNQLNPEVH HRPFTQEEDA LILAAHAHYG NRWAAIARHL PGRTDNAIKN HWNSNLRKSR  120
RRAAAAAAAA AAVAIASTSR AAAPQVPFTG MLQGDNSNLT TAVPVAPQPT GWRRCVMSQG  180
QSSSEVIIPD ASANLVPNSN QSSVAHGPTV DPNTSLSLSL SLPVPPSNSH EAANKEPMEA  240
SIGMGENDIN NCSSSPSLMG GNAQLMAMIR QMVREEVQLQ TGQLAFSLRV EAASAKGHHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-38191194104C-Myb DNA-Binding Domain
1mse_C5e-38191194104C-Myb DNA-Binding Domain
1gv2_A5e-38191194104MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-371911958158MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-371911958158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002489094.12e-56hypothetical protein SORBIDRAFT_0088s002210
TrEMBLK3Z8T91e-74K3Z8T9_SETIT; Uncharacterized protein
STRINGSi022959m3e-74(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135442731